PDB entry 2j96

View 2j96 on RCSB PDB site
Description: The E-configuration of alfa-Phycoerythrocyanin
Class: photosynthesis
Keywords: electron transport, z- to e-isomerization, transport, chromophore, bile pigment, phycobilisome, photosynthesis, light harvesting, phycobiliproteins
Deposited on 2006-11-02, released 2007-01-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-07-25, with a file datestamp of 2012-07-20.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.235
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phycoerythrocyanin alpha chain
    Species: Mastigocladus laminosus [TaxId:83541]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2j96a_
  • Chain 'B':
    Compound: phycoerythrocyanin alpha chain
    Species: Mastigocladus laminosus [TaxId:83541]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2j96b_
  • Heterogens: PVN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2j96A (A:)
    mktplteaiaaadlrgsylsntelqavfgrfnraragleaarafanngkkwaeaaanhvy
    qkfpyttqmqgpqyastpegkakcvrdidhylrtisyccvvggtgplddyvvaglkefns
    alglspswyiaalefvrdnhgltgdvageantyinyainals
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2j96B (B:)
    mktplteaiaaadlrgsylsntelqavfgrfnraragleaarafanngkkwaeaaanhvy
    qkfpyttqmqgpqyastpegkakcvrdidhylrtisyccvvggtgplddyvvaglkefns
    alglspswyiaalefvrdnhgltgdvageantyinyainals