PDB entry 2hw8

View 2hw8 on RCSB PDB site
Description: Structure of ribosomal protein L1-mRNA complex at 2.1 resolution.
Class: structural protein/RNA
Keywords: ribosomal protein L1, mRNA, RNA-protein complex, STRUCTURAL PROTEIN/RNA COMPLEX
Deposited on 2006-08-01, released 2006-12-19
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.212
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 50s ribosomal protein l1
    Species: Thermus thermophilus [TaxId:274]
    Gene: rpl1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27150 (0-227)
      • modified residue (119)
      • conflict (126)
      • modified residue (217)
    Domains in SCOPe 2.03: d2hw8a1
  • Chain 'B':
    Compound: 36-mer
    Species: synthetic, synthetic
  • Heterogens: K, MG, BU1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2hw8A (A:)
pkhgkryrallekvdpnkiytideaahlvkelatakfdetvevhaklgidprrsdqnvrg
tvslphglgkqvrvlaiakgekikeaeeagadyvggeeiiqkildgwmdfdavvatpdvm
gavgskmgrilgprgllpnpkagtvgfnigeiireikagriefrndktgaihapvgkasf
ppekladnirafiraleahkpegakgtflrsvyvtttmgpsvrinphs

  • Chain 'B':
    No sequence available.