PDB entry 2hvf

View 2hvf on RCSB PDB site
Description: Crystal Structure of N-terminal Domain of Ribosomal Protein L9 (NTL9), G34dA
Class: structural protein
Keywords: L9, ribosomal protein, NTL9, G34dA, STRUCTURAL PROTEIN
Deposited on 2006-07-28, released 2007-06-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.57 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 50S ribosomal protein L9
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02417 (0-51)
      • engineered (33)
    Domains in SCOPe 2.07: d2hvfa1
  • Heterogens: ZN, CL, IMD, ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hvfA (A:)
    mkviflkdvkgkgkkgeiknvadgyannflfkqalaieatpanlkaleaqkq