PDB entry 2huw

View 2huw on RCSB PDB site
Description: X-ray crystal structure of the Grb2 SH2 domain complexed to a constrained and cyclopropane-derived ligand
Class: hormone/growth factor
Keywords: cylcopropane, contrained, Grb2, SH2, preorganization,, HORMONE/GROWTH FACTOR COMPLEX
Deposited on 2006-07-27, released 2006-08-15
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.195
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Growth factor receptor-bound protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: GRB2, ASH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2huwa_
  • Chain 'B':
    Compound: Growth factor receptor-bound protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: GRB2, ASH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2huwb_
  • Heterogens: PO4, YVN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2huwA (A:)
    iemkphpwffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlr
    dgagkyflwvvkfnslnelvdyhrstsvsrnqqiflrdieqvpqqptyvqhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2huwA (A:)
    mkphpwffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlrdg
    agkyflwvvkfnslnelvdyhrstsvsrnqqiflrdieqvp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2huwB (B:)
    iemkphpwffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlr
    dgagkyflwvvkfnslnelvdyhrstsvsrnqqiflrdieqvpqqptyvqhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2huwB (B:)
    kphpwffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlrdga
    gkyflwvvkfnslnelvdyhrstsvsrnqqiflrdieq