PDB entry 2hqn

View 2hqn on RCSB PDB site
Description: Structure of a Atypical Orphan Response Regulator Protein Revealed a New Phosphorylation-Independent Regulatory Mechanism
Class: signaling protein
Keywords: Phosporylation-Independent Response Regulator, SIGNALING PROTEIN
Deposited on 2006-07-19, released 2007-05-08
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative transcriptional regulator
    Species: Helicobacter pylori [TaxId:85963]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ZM42 (4-108)
      • cloning artifact (0-3)
    Domains in SCOPe 2.04: d2hqna_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hqnA (A:)
    gsgsnvieigdltispdeekiiykgrevevkgkpfevlthlarhrdqivskeqlldaiwe
    epemvtpnvievainqirqkmdkplgistvetvrrrgyrfcypkpacee