PDB entry 2hid

View 2hid on RCSB PDB site
Description: refined nmr structure of phosphocarrier histidine containing protein from bacillus subtilis
Deposited on 1996-05-17, released 1996-11-08
The last revision prior to the SCOP 1.57 freeze date was dated 1996-11-08, with a file datestamp of 1996-11-08.
Experiment type: NMR25
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.57: d2hid__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2hid_ (-)
  aqktfkvtadsgiharpatvlvqtaskydadvnleyngktvnlksimgvvslgiakgaei
  tisasgadendalnaleetmkseglge