PDB entry 2hdh

View 2hdh on RCSB PDB site
Description: biochemical characterization and structure determination of human heart short chain l-3-hydroxyacyl coa dehydrogenase provide insight into catalytic mechanism
Deposited on 1998-12-04, released 1999-05-12
The last revision prior to the SCOP 1.63 freeze date was dated 2000-03-27, with a file datestamp of 2000-03-27.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.198
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d2hdha1, d2hdha2
  • Chain 'B':
    no info in PDB for this chain

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hdhA (A:)
    kiivkhvtviggglmgagiaqvaaatghtvvlvdqtedilakskkgieeslrkvakkkfa
    enpkagdefvaktlstiatstdaasvvhstdlvveaivenlkvknelfkrldkraaehti
    fasntsslqitsianattrqdrfaglhffnpvpvmklveviktpmtsqktfeslvdfska
    lgkhpvsckdtpgfivnrllvpylmeairlyergdaskedidtamklgagypmgpfelld
    yvgldttkfivdgwhemdaenplhqpspslnklvaenkfgkktgegfykykaa
    

  • Chain 'B':
    No sequence available.