PDB entry 2fd6

View 2fd6 on RCSB PDB site
Description: Structure of Human Urokinase Plasminogen Activator in Complex with Urokinase Receptor and an anti-upar antibody at 1.9 A
Class: immune system, hydrolase
Keywords: uPAR, ATF, ATN-615 antibody, Fab, ternary complex, IMMUNE SYSTEM, HYDROLASE
Deposited on 2005-12-13, released 2006-02-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-07-18, with a file datestamp of 2012-07-13.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.239
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: urokinase-type plasminogen activator
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2fd6a1, d2fd6a2
  • Chain 'H':
    Compound: H chain of Fab of ATN-615 anti-uPAR antibody
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2fd6h1, d2fd6h2
  • Chain 'L':
    Compound: L chain of Fab of ATN-615 anti-uPAR antibody
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2fd6l1, d2fd6l2
  • Chain 'U':
    Compound: Urokinase plasminogen activator surface receptor
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q03405 (2-275)
      • cloning artifact (1)
    Domains in SCOPe 2.07: d2fd6u1, d2fd6u2, d2fd6u3
  • Heterogens: SO4, ETX, EDO, PGE, NAG, NDG, PG4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fd6A (A:)
    cdclnggtcvsnkyfsnihwcncpkkfggqhceidksktcyegnghfyrgkastdtmgrp
    clpwnsatvlqqtyhahrsdalqlglgkhnycrnpdnrrrpwcyvqvglkplvqecmvhd
    ca
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2fd6H (H:)
    gvklqqsgpevvkpgasvkisckasgysftnfyihwvkqrpgqglewigwifhgsdntey
    nekfkdkatltadtssstaymqlssltsedsavyfcarwgphwyfdvwgqgttvtvssak
    ttppsvyplapgnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsss
    vtvpsstwpsetvtcnvahpasstkvdkkiaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fd6H (H:)
    gvklqqsgpevvkpgasvkisckasgysftnfyihwvkqrpgqglewigwifhgsdntey
    nekfkdkatltadtssstaymqlssltsedsavyfcarwgphwyfdvwgqgttvtvssak
    ttppsvyplapnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsssv
    tvpsstwpsetvtcnvahpasstkvdkkiaaa
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fd6L (L:)
    divltqspditaaslgqkvtitcsasssvsymhwyqqksgtspkpwifeisklasgvpar
    fsgsgsgtsysltissmeaedaaiyycqqwnypftfgggtkleikradaaptvsifppss
    eqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltlt
    kdeyerhnsytceathktstspivksfnrneaka
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >2fd6U (U:)
    slrcmqcktngdcrveecalgqdlcrttivrlweegeelelvekscthsektnrtlsyrt
    glkitsltevvcgldlcnqgnsgravtysrsryleciscgssdmscergrhqslqcrspe
    eqcldvvthwiqegeegrpkddrhlrgcgylpgcpgsngfhnndtfhflkccnttkcneg
    pilelenlpqngrqcysckgnsthgcsseetflidcrgpmnqclvatgthepknqsymvr
    gcatasmcqhahlgdafsmnhidvscctksgcnhpd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fd6U (U:)
    slrcmqcktngdcrveecalgqdlcrttivrlweelelvekscthsektnrtlsyrtglk
    itsltevvcgldlcnqgnyleciscgssdmscergrhqslqcrspeeqcldvvthwddrh
    lrgcgylpgcpgsngfhnndtfhflkccnttkcnegpilelenlpqngrqcysckgnsth
    gcsseetflidcrgpmnqclvatgthepknqsymvrgcatasmcqlgdafsmnhidvscc
    tksgcnhpd