PDB entry 2fac

View 2fac on RCSB PDB site
Description: Crystal structure of E. coli hexanoyl-ACP
Class: biosynthetic protein
Keywords: acyl carrier protein, acyl chain binding, fatty acid biosynthesis, BIOSYNTHETIC PROTEIN
Deposited on 2005-12-07, released 2006-09-26
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: 0.184
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Acyl carrier protein
  Species: Escherichia coli [TaxId:562]
  Gene: acpP
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A6A8 (0-76)
  Domains in SCOPe 2.04: d2faca_
• Chain 'B':
  Compound: Acyl carrier protein
  Species: Escherichia coli [TaxId:562]
  Gene: acpP
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A6A8 (0-76)
  Domains in SCOPe 2.04: d2facb_
• Heterogens: ZN, PM4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2facA (A:)
  stieervkkiigeqlgvkqeevtnnasfvedlgadsldtvelvmaleeefdteipdeeae
  kittvqaaidyinghqa
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2facB (B:)
  stieervkkiigeqlgvkqeevtnnasfvedlgadsldtvelvmaleeefdteipdeeae
  kittvqaaidyinghqa