PDB entry 2eyi

View 2eyi on RCSB PDB site
Description: Crystal structure of the actin-binding domain of human alpha-actinin 1 at 1.7 Angstrom resolution
Class: structural protein
Keywords: calponin homology domain, CH domain, Structural Protein, Actin-binding, Actin-crosslinking, Actin-bundling
Deposited on 2005-11-09, released 2006-08-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Alpha-actinin 1
  Species: Homo sapiens [TaxId:9606]
  Gene: ACTN1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P12814 (4-227)
    • cloning artifact (0-3)
    • cloning artifact (228-233)
  Domains in SCOPe 2.07: d2eyia1, d2eyia2, d2eyia3, d2eyia4
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2eyiA (A:)
  aghmekqqrktftawcnshlrkagtqienieedfrdglklmlllevisgerlakpergkm
  rvhkisnvnkaldfiaskgvklvsigaeeivdgnvkmtlgmiwtiilrfaiqdisveets
  akeglllwcqrktapyknvniqnfhiswkdglgfcalihrhrpelidygklrkddpltnl
  ntafdvaekyldipkmldaedivgtarpdekaimtyvssfyhafsgaqeflepg