PDB entry 2er6

View 2er6 on RCSB PDB site
Description: The structure of a synthetic pepsin inhibitor complexed with endothiapepsin.
Class: hydrolase/hydrolase inhibitor
Keywords: hydrolase-hydrolase inhibitor complex, acid proteinase
Deposited on 1990-10-13, released 1991-01-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: endothiapepsin
    Species: Cryphonectria parasitica [TaxId:5116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2er6e_
  • Chain 'I':
    Compound: H-256 peptide
    Database cross-references and differences (RAF-indexed):
    • PDB 2ER6 (0-5)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2er6E (E:)
stgsatttpidslddayitpvqigtpaqtlnldfdtgssdlwvfssettasevdgqtiyt
psksttakllsgatwsisygdgssssgdvytdtvsvggltvtgqavesakkvsssfteds
tidgllglafstlntvsptqqktffdnakasldspvftadlgyhapgtynfgfidttayt
gsitytavstkqgfwewtstgyavgsgtfkstsidgiadtgttllylpatvvsaywaqvs
gakssssvggyvfpcsatlpsftfgvgsarivipgdyidfgpistgssscfggiqssagi
ginifgdvalkaafvvfngattptlgfask

  • Chain 'I':
    No sequence available.