PDB entry 2ebz

View 2ebz on RCSB PDB site
Description: Solution structure of the RGS domain from human Regulator of G-protein signaling 12 (RGS12)
Class: signaling protein
Keywords: RGS domain, Regulator of G-protein signaling 12, RGS12, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN
Deposited on 2007-02-09, released 2008-03-04
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Regulator of G-protein signaling 12
    Species: Homo sapiens [TaxId:9606]
    Gene: RGS12
    Database cross-references and differences (RAF-indexed):
    • Uniprot O14924 (7-154)
      • expression tag (0-6)
    Domains in SCOPe 2.04: d2ebza_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ebzA (A:)
    gssgssgrerrvaswavsferllqdpvgvryfsdflrkefseenilfwqaceyfnhvpah
    dkkelsyrareifskflcskattpvnidsqaqladdvlraphpdmfkeqqlqifnlmkfd
    sytrflksplyqecilaevegralpdsqqvpsspa