PDB entry 2e8n

View 2e8n on RCSB PDB site
Description: Solution structure of the C-terminal SAM-domain of EphaA2: Ephrin type-A receptor 2 precursor (EC 2.7.10.1)
Class: transferase, signaling protein
Keywords: CELL-FREE PROTEIN SYNTHESIS, PROTEIN REGULATION, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSFERASE, SIGNALING PROTEIN
Deposited on 2007-01-22, released 2008-01-29
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ephrin type-A receptor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: EphA2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29317 (7-81)
      • expression tag (0-6)
      • engineered (49)
      • expression tag (82-87)
    Domains in SCOPe 2.04: d2e8na_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2e8nA (A:)
gssgssgegvpfrtvsewlesikmqqytehfmaagytaiekvvqmtnddvkrigvrlpgh
qkriaysllglkdqvntvgipisgpssg