PDB entry 2e46

View 2e46 on RCSB PDB site
Description: Crystal Structure Analysis of the clock protein EA4
Class: metal binding protein
Keywords: metalloprotein, METAL BINDING PROTEIN
Deposited on 2006-12-05, released 2008-02-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.212
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Time interval measuring enzyme TIME
    Species: Bombyx mori [TaxId:7091]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q08J22 (1-156)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d2e46a_
  • Heterogens: CU, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2e46A (A:)
    mhhgfttpsraiavlstetirgnitftqvqdgkvhvqggitglppgeygfhvhekgdlsg
    gclstgshfnpehkdhghpndvnrhvgdlgnvvfdenhysridlvddqislsgphgiigr
    avvlhekaddygksdhpdsrktgnaggrvacgvigil