PDB entry 2e2c

View 2e2c on RCSB PDB site
Description: e2-c, an ubiquitin conjugating enzyme required for the destruction of mitotic cyclins
Class: ubiquitin conjugation
Keywords: ubiquitin conjugation, ubiquitin carrier protein, thioester bond, ligase
Deposited on 1999-01-19, released 1999-01-27
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-03-20, with a file datestamp of 2013-03-15.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.216
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: ubiquitin conjugating enzyme
  Species: Spisula solidissima [TaxId:6584]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q95044 (0-155)
  Domains in SCOPe 2.04: d2e2ca_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2e2cA (A:)
  mttskerhsvskrlqqelrtllmsgdpgitafpdgdnlfkwvatldgpkdtvyeslkykl
  tlefpsdypykppvvkfttpcwhpnvdqsgnicldilkenwtasydvrtillslqsllge
  pnnasplnaqaadmwsnqteykkvlhekyktaqsdk