PDB entry 2dkx

View 2dkx on RCSB PDB site
Description: Solution structure of the SAM_PNT-domain of ETS transcription factor PDEF (Prostate ets)
Class: signaling protein
Keywords: CELL-FREE PROTEIN SYNTHESIS, PROTEIN REGULATION, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN
Deposited on 2006-04-14, released 2006-10-14
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: SAM pointed domain-containing Ets transcription factor
    Species: Homo sapiens [TaxId:9606]
    Gene: SPDEF, PDEF, PSE
    Database cross-references and differences (RAF-indexed):
    • Uniprot O95238 (7-89)
      • cloning artifact (0-6)
      • cloning artifact (90-95)
    Domains in SCOPe 2.04: d2dkxa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2dkxA (A:)
    gssgssglkdietackllnitadpmdwspsnvqkwllwtehqyrlppmgkafqelagkel
    camseeqfrqrsplggdvlhahldiwksaasgpssg