PDB entry 2d89

View 2d89 on RCSB PDB site
Description: Solution structure of the CH domain from human EH domain binding protein 1
Class: structural protein, protein binding
Keywords: all alpha, calponin homology domain, actin binding, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, STRUCTURAL PROTEIN, PROTEIN BINDING
Deposited on 2005-12-02, released 2006-06-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: EHBP1 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: EHBP1
    Database cross-references and differences (RAF-indexed):
    • GB AAH67215 (7-112)
      • cloning artifact (0-6)
      • cloning artifact (113-118)
    Domains in SCOPe 2.07: d2d89a1, d2d89a2, d2d89a3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2d89A (A:)
    gssgssgpnasqsllvwckevtknyrgvkitnfttswrnglsfcailhhfrpdlidyksl
    npqdikennkkaydgfasigisrllepsdmvllaipdkltvmtylyqirahfssgpssg