PDB entry 2d88

View 2d88 on RCSB PDB site
Description: Solution structure of the CH domain from human MICAL-3 protein
Class: signaling protein, protein binding
Keywords: all alpha, calponin homology domain, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN, PROTEIN BINDING
Deposited on 2005-12-02, released 2006-06-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein MICAL-3
    Species: Homo sapiens [TaxId:9606]
    Gene: MICAL3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7RTP6 (7-114)
      • cloning artifact (0-6)
      • cloning artifact (115-120)
    Domains in SCOPe 2.07: d2d88a1, d2d88a2, d2d88a3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2d88A (A:)
gssgssgvarsskllgwcqrqtdgyagvnvtdltmswksglalcaiihryrpdlidfdsl
deqnveknnqlafdiaekelgispimtgkemasvgepdklsmvmyltqfyemfkdsgpss
g