PDB entry 2d86

View 2d86 on RCSB PDB site
Description: Solution structure of the CH domain from human Vav-3 protein
Class: signaling protein, protein binding
Keywords: all alpha, calponin homology domain, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN, PROTEIN BINDING
Deposited on 2005-12-02, released 2006-12-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Vav-3 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: VAV3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UKW4 (7-136)
      • cloning artifact (0-6)
      • cloning artifact (137-142)
    Domains in SCOPe 2.07: d2d86a1, d2d86a2, d2d86a3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2d86A (A:)
gssgssgmepwkqcaqwlihckvlptnhrvtwdsaqvfdlaqtlrdgvllcqllnnlrah
sinlkeinlrpqmsqflclknirtfltaccetfgmrkselfeafdlfdvrdfgkvietls
rlsrtpialatgirpfpsgpssg