PDB entry 2d4d

View 2d4d on RCSB PDB site
Description: The Crystal Structure of human beta2-microglobulin, L39W W60F W95F Mutant
Class: immune system
Keywords: Immunoglobulin constant domain, IMMUNE SYSTEM
Deposited on 2005-10-17, released 2006-08-08
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.218
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-2-microglobulin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61769 (1-End)
      • cloning artifact (0)
      • engineered (39)
      • engineered (60)
      • engineered (95)
    Domains in SCOPe 2.03: d2d4da_
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2d4dA (A:)
miqrtpkiqvysrhpaengksnflncyvsgfhpsdievdwlkngeriekvehsdlsfskd
fsfyllyyteftptekdeyacrvnhvtlsqpkivkfdrdm

    Sequence, based on observed residues (ATOM records): (download) 
    >2d4dA (A:)
miqrtpkiqvysrhpaengksnflncyvsgfhpsdievdwlkngeriekvehsdlsfskd
fsfyllyyteftptekdeyacrvnhvtlsqpkivkf