PDB entry 2d1v

View 2d1v on RCSB PDB site
Description: Crystal structure of DNA-binding domain of Bacillus subtilis YycF
Class: transcription
Keywords: helix-turn-helix motif, DNA-binding domain, two-component system, response regulator, TRANSCRIPTION
Deposited on 2005-09-01, released 2006-09-12
The last revision prior to the SCOPe 2.04 freeze date was dated 2008-12-09, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.228
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcriptional regulatory protein yycF
    Species: Bacillus subtilis [TaxId:1423]
    Gene: yycF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2d1va_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2d1vA (A:)
eepssneihigslvifpdayvvskrdetielthrefellhylakhigqvmtrehllqtvw
gydyfgdvrtvdvtvrrlrekiednpshpnwivtrrgvgyylrnpeqd

    Sequence, based on observed residues (ATOM records): (download) 
    >2d1vA (A:)
ssneihigslvifpdayvvskrdetielthrefellhylakhigqvmtrehllqtvwgyd
yfgdvrtvdvtvrrlrekiednpshpnwivtrrgvgyylrnpe