PDB entry 2c9q

View 2c9q on RCSB PDB site
Description: cu(I)cu(II)-copc at ph 7.5
Class: electron transport(copper binding)
Keywords: electron transport(copper binding), copper transport, copper proteins, copper dissociation constants, metal-binding, electron transport
Deposited on 2005-12-14, released 2006-05-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.189
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: copper resistance protein c
    Species: Pseudomonas syringae pv. tomato [TaxId:323]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2c9qa_
  • Heterogens: CU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2c9qA (A:)
hpklvsstpaegsegaapakielhfsenlvtqfsgaklvmtampgmehspmavkaavsgg
gdpktmvitpaspltagtykvdwravssdthpitgsvtfkvk