PDB entry 2bzc

View 2bzc on RCSB PDB site
Description: oxidized and reduced structures of a mutant plastocyanin of fern
Class: electron transport
Keywords: plastocyanin, fern, chloroplast, electron transport, membrane, metal-binding
Deposited on 2005-08-15, released 2006-11-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 1.79 Å
R-factor: 0.193
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: plastocyanin
  Species: DRYOPTERIS CRASSIRHIZOMA [TaxId:97234]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q7SIB8 (0-101)
    • engineered mutation (35)
  Domains in SCOPe 2.08: d2bzca_
• Heterogens: CU1, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2bzcA (A:)
  akvevgdevgnfkfypdsitvsageaveftlvgetphnivfdipagapgtvaselkaasm
  dendllsedepsfkakvstpgtytfyctphksanmkgtltvk