PDB entry 2btf

View 2btf on RCSB PDB site
Description: the structure of crystalline profilin-beta-actin
Class: acetylation and actin-binding
Keywords: acetylation and actin-binding
Deposited on 1994-01-18, released 1994-06-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-actin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2btfa1, d2btfa2
  • Chain 'P':
    Compound: Profilin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2btfp_
  • Heterogens: SR, ATP

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2btfA (A:)
    dddiaalvvdngsgmckagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqsk
    rgiltlkypiehgivtnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmtq
    imfetfntpamyvaiqavlslyasgrttgivmdsgdgvthtvpiyegyalphailrldla
    grdltdylmkiltergysftttaereivrdikeklcyvaldfeqemataassssleksye
    lpdgqvitignerfrcpealfqpsflgmescgihettfnsimkcdvdirkdlyantvlsg
    gttmypgiadrmqkeitalapstmkikiiapperkysvwiggsilaslstfqqmwiskqe
    ydesgpsivhrkcf
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2btfP (P:)
    agwnayidnlmadgtcqdaaivgykdspsvwaavpgktfvnitpaevgilvgkdrssffv
    ngltlggqkcsvirdsllqdgeftmdlrtkstggaptfnitvtmtaktlvllmgkegvhg
    gminkkcyemashlrrsqy