PDB entry 2bdn

View 2bdn on RCSB PDB site
Description: Crystal structure of human MCP-1 bound to a blocking antibody, 11K2
Class: immune system
Keywords: antibody-antigen complex, immune system
Deposited on 2005-10-20, released 2006-06-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.53 Å
R-factor: 0.22
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Small inducible cytokine A2
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2bdna1
  • Chain 'H':
    Compound: Antibody heavy chain 11K2
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BDN (0-216)
    Domains in SCOPe 2.07: d2bdnh1, d2bdnh2
  • Chain 'L':
    Compound: Antibody light chain 11K2
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BDN (0-213)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bdnA (A:)
    qpdainapvtccynftnrkisvqrlasyrritsskcpkeavifktivakeicadpkqkwv
    qdsmdhldkqtqtpkt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bdnA (A:)
    ainapvtccynftnrkisvqrlasyrritsskcpkeavifktivakeicadpkqkwvqds
    mdhldkqt
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bdnH (H:)
    evqlqqsgaelvkagasvklscpasglnikdtymhwvkqrpeqglewigridpangntkf
    dpkfqgkatitadtssntaylqlssltsedtavyycargvfgffdywgqgttltvssakt
    tapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlyt
    lsssvtvtsstwpsqsitcnvahpasstkvdkkivpr
    

  • Chain 'L':
    No sequence available.