PDB entry 2b96

View 2b96 on RCSB PDB site
Description: Third Calcium ion found in an inhibitor bound phospholipase A2
Class: hydrolase
Keywords: Alpha Helix, Beta Sheet, triple mutant, anisic acid, HYDROLASE
Deposited on 2005-10-11, released 2006-03-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.202
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: phospholipase a2
  Species: Bos taurus [TaxId:9913]
  Gene: PLA2G1B
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00593 (0-122)
    • engineered (52)
    • engineered (55)
    • engineered (120)
  Domains in SCOPe 2.07: d2b96a_
• Heterogens: CA, CL, TRS, ANN, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2b96A (A:)
  alwqfngmikckipsseplldfnnygcycglggsgtpvddldrccqthdncymqamklds
  ckvlvdnpytnnysyscsnneitcssennaceaficncdrnaaicfskvpynkehknldk
  mnc