PDB entry 2ay0

View 2ay0 on RCSB PDB site
Description: Structure of the Lys9Met mutant of the E. coli Proline Utilization A (PutA) DNA-binding domain.
Class: DNA binding protein
Keywords: PutA, ribbon-helix-helix, dna-binding domain, proline catabolism, proline utilization A, DNA BINDING PROTEIN
Deposited on 2005-09-06, released 2006-08-15
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.206
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bifunctional putA protein
    Species: Escherichia coli [TaxId:562]
    Gene: putA, poaA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09546
      • engineered (8)
    Domains in SCOPe 2.03: d2ay0a1
  • Chain 'B':
    Compound: Bifunctional putA protein
    Species: Escherichia coli [TaxId:562]
    Gene: putA, poaA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09546
      • engineered (8)
    Domains in SCOPe 2.03: d2ay0b_
  • Chain 'C':
    Compound: Bifunctional putA protein
    Species: Escherichia coli [TaxId:562]
    Gene: putA, poaA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09546
      • engineered (8)
    Domains in SCOPe 2.03: d2ay0c_
  • Chain 'D':
    Compound: Bifunctional putA protein
    Species: Escherichia coli [TaxId:562]
    Gene: putA, poaA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09546
      • engineered (8)
    Domains in SCOPe 2.03: d2ay0d_
  • Chain 'E':
    Compound: Bifunctional putA protein
    Species: Escherichia coli [TaxId:562]
    Gene: putA, poaA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09546
      • engineered (8)
    Domains in SCOPe 2.03: d2ay0e_
  • Chain 'F':
    Compound: Bifunctional putA protein
    Species: Escherichia coli [TaxId:562]
    Gene: putA, poaA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09546
      • engineered (8)
    Domains in SCOPe 2.03: d2ay0f_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ay0A (A:)
    mgtttmgvmlddatreriksaatridrtphwlikqaifsyleqlensdtlpehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ay0A (A:)
    tttmgvmlddatreriksaatridrtphwlikqaifsyleqle
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ay0B (B:)
    mgtttmgvmlddatreriksaatridrtphwlikqaifsyleqlensdtlpehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ay0B (B:)
    tttmgvmlddatreriksaatridrtphwlikqaifsyleql
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2ay0C (C:)
    mgtttmgvmlddatreriksaatridrtphwlikqaifsyleqlensdtlpehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ay0C (C:)
    gtttmgvmlddatreriksaatridrtphwlikqaifsyleqle
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2ay0D (D:)
    mgtttmgvmlddatreriksaatridrtphwlikqaifsyleqlensdtlpehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ay0D (D:)
    tttmgvmlddatreriksaatridrtphwlikqaifsyleqlens
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2ay0E (E:)
    mgtttmgvmlddatreriksaatridrtphwlikqaifsyleqlensdtlpehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ay0E (E:)
    gtttmgvmlddatreriksaatridrtphwlikqaifsyleqle
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2ay0F (F:)
    mgtttmgvmlddatreriksaatridrtphwlikqaifsyleqlensdtlpehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ay0F (F:)
    tttmgvmlddatreriksaatridrtphwlikqaifsyleqle