PDB entry 2ay0
View 2ay0 on RCSB PDB site
Description: Structure of the Lys9Met mutant of the E. coli Proline Utilization A (PutA) DNA-binding domain.
Class: DNA binding protein
Keywords: PutA, ribbon-helix-helix, dna-binding domain, proline catabolism, proline utilization A, DNA BINDING PROTEIN
Deposited on
2005-09-06, released
2006-08-15
The last revision prior to the SCOPe 2.03 freeze date was dated
2011-07-13, with a file datestamp of
2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.206
AEROSPACI score: 0.44
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Bifunctional putA protein
Species: Escherichia coli [TaxId:562]
Gene: putA, poaA
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.03: d2ay0a1 - Chain 'B':
Compound: Bifunctional putA protein
Species: Escherichia coli [TaxId:562]
Gene: putA, poaA
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.03: d2ay0b_ - Chain 'C':
Compound: Bifunctional putA protein
Species: Escherichia coli [TaxId:562]
Gene: putA, poaA
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.03: d2ay0c_ - Chain 'D':
Compound: Bifunctional putA protein
Species: Escherichia coli [TaxId:562]
Gene: putA, poaA
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.03: d2ay0d_ - Chain 'E':
Compound: Bifunctional putA protein
Species: Escherichia coli [TaxId:562]
Gene: putA, poaA
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.03: d2ay0e_ - Chain 'F':
Compound: Bifunctional putA protein
Species: Escherichia coli [TaxId:562]
Gene: putA, poaA
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.03: d2ay0f_ - Heterogens: CL, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>2ay0A (A:)
mgtttmgvmlddatreriksaatridrtphwlikqaifsyleqlensdtlpehhhhhh
Sequence, based on observed residues (ATOM records): (download)
>2ay0A (A:)
tttmgvmlddatreriksaatridrtphwlikqaifsyleqle
- Chain 'B':
Sequence, based on SEQRES records: (download)
>2ay0B (B:)
mgtttmgvmlddatreriksaatridrtphwlikqaifsyleqlensdtlpehhhhhh
Sequence, based on observed residues (ATOM records): (download)
>2ay0B (B:)
tttmgvmlddatreriksaatridrtphwlikqaifsyleql
- Chain 'C':
Sequence, based on SEQRES records: (download)
>2ay0C (C:)
mgtttmgvmlddatreriksaatridrtphwlikqaifsyleqlensdtlpehhhhhh
Sequence, based on observed residues (ATOM records): (download)
>2ay0C (C:)
gtttmgvmlddatreriksaatridrtphwlikqaifsyleqle
- Chain 'D':
Sequence, based on SEQRES records: (download)
>2ay0D (D:)
mgtttmgvmlddatreriksaatridrtphwlikqaifsyleqlensdtlpehhhhhh
Sequence, based on observed residues (ATOM records): (download)
>2ay0D (D:)
tttmgvmlddatreriksaatridrtphwlikqaifsyleqlens
- Chain 'E':
Sequence, based on SEQRES records: (download)
>2ay0E (E:)
mgtttmgvmlddatreriksaatridrtphwlikqaifsyleqlensdtlpehhhhhh
Sequence, based on observed residues (ATOM records): (download)
>2ay0E (E:)
gtttmgvmlddatreriksaatridrtphwlikqaifsyleqle
- Chain 'F':
Sequence, based on SEQRES records: (download)
>2ay0F (F:)
mgtttmgvmlddatreriksaatridrtphwlikqaifsyleqlensdtlpehhhhhh
Sequence, based on observed residues (ATOM records): (download)
>2ay0F (F:)
tttmgvmlddatreriksaatridrtphwlikqaifsyleqle