PDB entry 2awt

View 2awt on RCSB PDB site
Description: Solution Structure of Human Small Ubiquitin-Like Modifier Protein Isoform 2 (SUMO-2)
Class: protein transport
Keywords: ubiquitin fold, half-open barrel, two helices, PROTEIN TRANSPORT
Deposited on 2005-09-02, released 2006-10-24
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Small ubiquitin-related modifier 2
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P61956 (0-94)
  Domains in SCOPe 2.03: d2awta1

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2awtA (A:)
  madekpkegvktenndhinlkvagqdgsvvqfkikrhtplsklmkaycerqglsmrqirf
  rfdgqpinetdtpaqlemededtidvfqqqtggvy