PDB entry 2aq9

View 2aq9 on RCSB PDB site
Description: Structure of E. coli LpxA with a bound peptide that is competitive with acyl-ACP
Class: transferase/transferase inhibitor
Keywords: LpxA, peptide inhibitor, acyl ACP, ACP, UDP-glcNac, Lipid A, TRANSFERASE-TRANSFERASE INHIBITOR COMPLEX
Deposited on 2005-08-17, released 2006-06-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.194
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acyl-[acyl-carrier-protein]--udp-n-acetylglucosamine o-acyltransferase
    Species: Escherichia coli [TaxId:83333]
    Gene: lpxA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2aq9a_
  • Chain 'X':
    Compound: peptide inhibitor
    Database cross-references and differences (RAF-indexed):
    • PDB 2AQ9 (Start-14)
  • Heterogens: PO4, DMS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2aq9A (A:)
midksafvhptaiveegasiganahigpfcivgphveigegtvlkshvvvnghtkigrdn
eiyqfasigevnqdlkyageptrveigdrnriresvtihrgtvqgggltkvgsdnllmin
ahiahdctvgnrcilannatlaghvsvddfaiiggmtavhqfciigahvmvggcsgvaqd
vppyviaqgnhatpfgvnieglkrrgfsreaitairnaykliyrsgktldevkpeiaela
etypevkaftdffarstrglir

  • Chain 'X':
    No sequence available.