PDB entry 2ak5
View 2ak5 on RCSB PDB site
Description: beta PIX-SH3 complexed with a Cbl-b peptide
Class: endocytosis/exocytosis
Keywords: adaptor proteins, Cin85, PIX/COOL, Cbl, protein-protein interaction, X-ray, endocytosis, ENDOCYTOSIS/EXOCYTOSIS COMPLEX
Deposited on
2005-08-03, released
2005-10-11
The last revision prior to the SCOPe 2.07 freeze date was dated
2009-02-24, with a file datestamp of
2009-02-03.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.22
AEROSPACI score: 0.45
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Rho guanine nucleotide exchange factor 7
Species: Rattus norvegicus [TaxId:10116]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d2ak5a_ - Chain 'B':
Compound: Rho guanine nucleotide exchange factor 7
Species: Rattus norvegicus [TaxId:10116]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d2ak5b1, d2ak5b2 - Chain 'D':
Compound: 8-residue peptide from a signal transduction protein CBL-B
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
- Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>2ak5A (A:)
gsansqlvvrakfnfqqtnedelsfskgdvihvtrveeggwwegthngrtgwfpsnyvre
ikps
Sequence, based on observed residues (ATOM records): (download)
>2ak5A (A:)
nsqlvvrakfnfqqtnedelsfskgdvihvtrveeggwwegthngrtgwfpsnyvreikp
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>2ak5B (B:)
gsansqlvvrakfnfqqtnedelsfskgdvihvtrveeggwwegthngrtgwfpsnyvre
ikps
- Chain 'D':
No sequence available.