PDB entry 2ak5

View 2ak5 on RCSB PDB site
Description: beta PIX-SH3 complexed with a Cbl-b peptide
Class: endocytosis/exocytosis
Keywords: adaptor proteins, Cin85, PIX/COOL, Cbl, protein-protein interaction, X-ray, endocytosis, ENDOCYTOSIS/EXOCYTOSIS COMPLEX
Deposited on 2005-08-03, released 2005-10-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.22
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Rho guanine nucleotide exchange factor 7
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ak5a_
  • Chain 'B':
    Compound: Rho guanine nucleotide exchange factor 7
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O55043 (2-63)
      • cloning artifact (0-1)
    Domains in SCOPe 2.07: d2ak5b1, d2ak5b2
  • Chain 'D':
    Compound: 8-residue peptide from a signal transduction protein CBL-B
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ak5A (A:)
    gsansqlvvrakfnfqqtnedelsfskgdvihvtrveeggwwegthngrtgwfpsnyvre
    ikps
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ak5A (A:)
    nsqlvvrakfnfqqtnedelsfskgdvihvtrveeggwwegthngrtgwfpsnyvreikp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ak5B (B:)
    gsansqlvvrakfnfqqtnedelsfskgdvihvtrveeggwwegthngrtgwfpsnyvre
    ikps
    

  • Chain 'D':
    No sequence available.