PDB entry 2ajs

View 2ajs on RCSB PDB site
Description: Crystal structure of cocaine catalytic antibody 7A1 Fab' in complex with heptaethylene glycol
Class: immune system
Keywords: CATALYTIC Antibody, Fab, COCAINE, HYDROLYTIC, Heptaethylene glycol, IMMUNE SYSTEM
Deposited on 2005-08-02, released 2006-02-14
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.209
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'H':
  Compound: Antibody 7A1 Fab'
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • PDB 2AJS (0-218)
• Chain 'L':
  Compound: Antibody 7A1 Fab'
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • PDB 2AJS (0-215)
  Domains in SCOPe 2.03: d2ajsl1, d2ajsl2
• Heterogens: SO4, P33, GOL, HOH

PDB Chain Sequences:

• Chain 'H':
  No sequence available.
  
  
• Chain 'L':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2ajsL (L:)
  divitqdelsnpvtsgesvsiscrssrsllykdgrtylnwflqrpgqspqlliylmstra
  sgvsdrfsgsgsgtdftleisrvkaedvgvyycqqfveypftfgsgtkleikradaaptv
  sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
  sstltltkdeyerhnsytceathktstspivksfnr