PDB entry 1zvn

View 1zvn on RCSB PDB site
Description: Crystal structure of chick MN-cadherin EC1
Class: cell adhesion
Keywords: cadherin, CELL ADHESION
Deposited on 2005-06-02, released 2006-04-25
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-04-10, with a file datestamp of 2013-04-05.
Experiment type: XRAY
Resolution: 2.16 Å
R-factor: 0.173
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cadherin 1
    Species: Gallus gallus [TaxId:9031]
    Gene: MNcadherin
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7ZYV7 (2-98)
      • cloning artifact (0-1)
    Domains in SCOPe 2.03: d1zvna_
  • Chain 'B':
    Compound: Cadherin 1
    Species: Gallus gallus [TaxId:9031]
    Gene: MNcadherin
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7ZYV7 (2-98)
      • cloning artifact (0-1)
    Domains in SCOPe 2.03: d1zvnb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zvnA (A:)
    sgwvwnqffvleeytgtdplyvgklhsdmdrgdgsikyilsgegagivftiddttgdiha
    iqrldreersqytlraqaldrrtgrpmepesefiikiqd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zvnB (B:)
    sgwvwnqffvleeytgtdplyvgklhsdmdrgdgsikyilsgegagivftiddttgdiha
    iqrldreersqytlraqaldrrtgrpmepesefiikiqd