PDB entry 1zoo

View 1zoo on RCSB PDB site
Description: cd11a I-domain with bound magnesium ion
Class: cell adhesion
Keywords: integrin, cell adhesion, glycoprotein, transmembrane, extracellular matrix, cytoskeleton, signal
Deposited on 1996-06-21, released 1996-12-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.279
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: leukocyte adhesion glycoprotein
    Species: Homo sapiens [TaxId:9606]
    Gene: PCR PRODUCT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1zooa_
  • Chain 'B':
    Compound: leukocyte adhesion glycoprotein
    Species: Homo sapiens [TaxId:9606]
    Gene: PCR PRODUCT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1zoob_
  • Heterogens: MG, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zooA (A:)
    cikgnvdlvflfdgsmslqpdefqkildfmkdvmkklsntsyqfaavqfstsyktefdfs
    dyvkrkdpdallkhvkhmllltntfgainyvatevfreelgarpdatkvliiitdgeatd
    sgnidaakdiiryiigigkhfqtkesqetlhkfaskpasefvkildtfeklkdlftelqk
    kiyvieg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zooA (A:)
    gnvdlvflfdgsmslqpdefqkildfmkdvmkklsntsyqfaavqfstsyktefdfsdyv
    krkdpdallkhvkhmllltntfgainyvatevfreelgarpdatkvliiitdgeatdsgn
    idaakdiiryiigigkhfqtkesqetlhkfaskpasefvkildtfeklkdlftelqkkiy
    vie
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1zooB (B:)
    cikgnvdlvflfdgsmslqpdefqkildfmkdvmkklsntsyqfaavqfstsyktefdfs
    dyvkrkdpdallkhvkhmllltntfgainyvatevfreelgarpdatkvliiitdgeatd
    sgnidaakdiiryiigigkhfqtkesqetlhkfaskpasefvkildtfeklkdlftelqk
    kiyvieg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zooB (B:)
    gnvdlvflfdgsmslqpdefqkildfmkdvmkklsntsyqfaavqfstsyktefdfsdyv
    krkdpdallkhvkhmllltntfgainyvatevfreelgarpdatkvliiitdgeatdsgn
    idaakdiiryiigigkhfqtkesqetlhkfaskpasefvkildtfeklkdlftelqkkiy
    vie