PDB entry 1zit

View 1zit on RCSB PDB site
Description: Structure of the receiver domain of NtrC4 from Aquifex aeolicus
Class: transcription regulator
Keywords: (beta/alpha)5, TRANSCRIPTION REGULATOR
Deposited on 2005-04-27, released 2006-05-09
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: transcriptional regulator (NtrC family)
  Species: Aquifex aeolicus [TaxId:224324]
  Gene: AQ_164
  Database cross-references and differences (RAF-indexed):
  • Uniprot O66551 (0-120)
  Domains in SCOPe 2.04: d1zita_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1zitA (A:)
  mkrvlvvddeesitsslsaileeegyhpdtaktlreaekkikelffpvivldvwmpdgdg
  vnfidfikenspdsvvivitghgsvdtavkaikkgayeflekpfsverflltikhafeey
  s