PDB entry 1z3k

View 1z3k on RCSB PDB site
Description: Structural Insight into the Binding Diversity between the Tyr-Phosphorylated Human EphrinBs and Nck2 SH2 Domain
Class: Structural Genomics, Unknown Function
Keywords: Nck2, SH2 domain, Eph receptor-ephrin mediated signaling, Structural Genomics, Unknown Function
Deposited on 2005-03-14, released 2005-03-29
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Cytoplasmic protein NCK2
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot O43639 (0-97)
  Domains in SCOPe 2.04: d1z3ka_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1z3kA (A:)
  rewyygnvtrhqaecalnergvegdflirdsesspsdfsvslkasgknkhfkvqlvdnvy
  cigqrrfhtmdelvehykkapiftsehgeklylvralq