PDB entry 1ymv

View 1ymv on RCSB PDB site
Description: signal transduction protein chey mutant with phe 14 replaced by gly, ser 15 replaced by gly, and met 17 replaced by gly
Deposited on 1995-12-14, released 1996-04-03
The last revision prior to the SCOP 1.57 freeze date was dated 1996-04-03, with a file datestamp of 1996-04-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.187
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d1ymv__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ymv_ (-)
    lkflvvddggtgrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwnmpnmdg
    lellktiradgamsalpvlmvtaeakkeniiaaaqagasgyvvkpftaatleeklnkife
    klgm