PDB entry 1ylb

View 1ylb on RCSB PDB site
Description: NMR solution structure of the reduced spinach plastocyanin
Class: electron transport
Keywords: plastocyanin, copper(+)-containing, electron-transfer, spinach, photosynthesis, blue-copper protein, ELECTRON TRANSPORT
Deposited on 2005-01-19, released 2005-04-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'B':
  Compound: Plastocyanin, chloroplast
  Species: Spinacia oleracea [TaxId:3562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00289 (0-98)
  Domains in SCOPe 2.07: d1ylbb_
• Heterogens: CU1

PDB Chain Sequences:

• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ylbB (B:)
  vevllgggdgslaflpgdfsvasgeeivfknnagfphnvvfdedeipsgvdaakismsee
  dllnapgetykvtltekgtykfycsphqgagmvgkvtvn