PDB entry 1yic

View 1yic on RCSB PDB site
Description: the oxidized saccharomyces cerevisiae iso-1-cytochrome c, nmr, 20 structures
Class: electron transport
Keywords: electron transport, cytochrome, ferricytochrome
Deposited on 1997-02-18, released 1997-07-23
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c, iso-1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00044 (0-107)
      • modified residue (76)
      • engineered (106)
    Domains in SCOPe 2.03: d1yica_
  • Heterogens: HEC

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yicA (A:)
    tefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
    nvlwdennmseyltnpkkyipgtkmafgglkkekdrndlitylkkase