PDB entry 1yaz

View 1yaz on RCSB PDB site
Description: azide-bound yeast cu(II)/zn superoxide dismutase room temperature (298k) structure
Class: oxidoreductase
Keywords: superoxide acceptor, copper, zinc, oxidoreductase
Deposited on 1998-12-23, released 2000-01-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein (cu/zn superoxide dismutase)
  Species: Saccharomyces cerevisiae [TaxId:4932]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00445 (0-152)
  Domains in SCOPe 2.07: d1yaza_
• Heterogens: CU, ZN, AZI, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1yazA (A:)
  vqavavlkgdagvsgvvkfeqasesepttvsyeiagnspnaergfhihefgdatngcvsa
  gphfnpfkkthgaptdevrhvgdmgnvktdengvakgsfkdslikligptsvvgrsvvih
  agqddlgkgdteeslktgnagprpacgvigltn