PDB entry 1y4o

View 1y4o on RCSB PDB site
Description: Solution structure of a mouse cytoplasmic Roadblock/LC7 dynein light chain
Class: contractile protein
Keywords: Structural Genomics, Protein Structure Initiative, PSI, Center for Eukaryotic Structural Genomics, CESG, Dynein Light Chain, CONTRACTILE PROTEIN
Deposited on 2004-12-01, released 2005-01-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dynein light chain 2A, cytoplasmic
    Species: Mus musculus [TaxId:10090]
    Gene: Dncl2a
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62627
      • expression tag (0-8)
    Domains in SCOPe 2.07: d1y4oa1, d1y4oa2
  • Chain 'B':
    Compound: Dynein light chain 2A, cytoplasmic
    Species: Mus musculus [TaxId:10090]
    Gene: Dncl2a
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62627 (9-103)
      • expression tag (0-8)
    Domains in SCOPe 2.07: d1y4ob2, d1y4ob3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1y4oA (A:)
    ghhhhhhleaeveetlkrlqsqkgvqgiivvntegipikstmdnptttqyanlmhnfilk
    arstvreidpqndltflrirskkneimvapdkdyfliviqnpte
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1y4oB (B:)
    ghhhhhhleaeveetlkrlqsqkgvqgiivvntegipikstmdnptttqyanlmhnfilk
    arstvreidpqndltflrirskkneimvapdkdyfliviqnpte