PDB entry 1xq8

View 1xq8 on RCSB PDB site
Description: Human micelle-bound alpha-synuclein
Class: lipid binding protein
Keywords: micelle-bound helix, LIPID BINDING PROTEIN
Deposited on 2004-10-11, released 2005-01-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alpha-synuclein
    Species: Homo sapiens [TaxId:9606]
    Gene: SNCA, NACP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1xq8a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1xq8A (A:)
mdvfmkglskakegvvaaaektkqgvaeaagktkegvlyvgsktkegvvhgvatvaektk
eqvtnvggavvtgvtavaqktvegagsiaaatgfvkkdqlgkneegapqegiledmpvdp
dneayempseegyqdyepea