PDB entry 1wki

View 1wki on RCSB PDB site
Description: solution structure of ribosomal protein L16 from thermus thermophilus HB8
Class: ribosome
Keywords: MIXED ALPHA/BETA, RIBOSOME, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2004-05-31, released 2004-12-14
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: LSU ribosomal protein L16P
    Species: Thermus thermophilus [TaxId:300852]
    Gene: RPLP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1wkia_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wkiA (A:)
    mlmprrmkyrkqqrgrlkgatkggdyvafgdyglvalepawitaqqieaarvamvrhfrr
    ggkifirifpdkpytkkplevrmgkgkgnvegyvavvkpgrvmfevagvteeqamealri
    aghklpiktkivrrdaydeaq