PDB entry 1wk2

View 1wk2 on RCSB PDB site
Description: Crystal structure of a hypothetical protein from thermus thermophilus HB8
Class: structural genomics, unknown function
Keywords: structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2004-05-30, released 2004-11-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.327
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hypothetical protein
  Species: Thermus thermophilus [TaxId:274]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5SM30 (0-End)
  Domains in SCOPe 2.08: d1wk2a_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1wk2A (A:)
  merpklglivrepyaslivdgrkvweirrrktrhrgplgivsggrligqadlvgvegpfs
  veellahqekhlaeeaflrayakdeplyawvlenafryekplhvprrpgrvmfvdlsevr
  w
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1wk2A (A:)
  merpklglivrepyaslivdgrkvweirrrktrhrgplgivsggrligqadlvgvplyaw
  vlenafryekplhvpmfvdlsevr