PDB entry 1wf2

View 1wf2 on RCSB PDB site
Description: Solution structure of RRM domain in HNRPC protein
Class: RNA binding protein
Keywords: NMR, structural genomics, RRM domain, HNRPC protein, RIKEN Structural Genomics/Proteomics Initiative, RSGI, RNA BINDING PROTEIN
Deposited on 2004-05-25, released 2004-11-25
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heterogeneous nuclear ribonucleoproteins C1/C2
    Species: Homo sapiens [TaxId:9606]
    Gene: adKA0528
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07910 (7-91)
      • cloning artifact (0-6)
      • cloning artifact (92-97)
    Domains in SCOPe 2.04: d1wf2a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wf2A (A:)
    gssgssgktdprsmnsrvfignlntlvvkksdveaifskygkivgcsvhkgfafvqyvne
    rnaraavagedgrmiagqvldinlaaepkvnrsgpssg