PDB entry 1vmo

View 1vmo on RCSB PDB site
Description: crystal structure of vitelline membrane outer layer protein I (vmo-I): a folding motif with homologous greek key structures related by an internal three-fold symmetry
Class: membrane protein
Keywords: membrane protein
Deposited on 1994-01-06, released 1994-05-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.188
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: vitelline membrane outer layer protein I
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vmoa_
  • Chain 'B':
    Compound: vitelline membrane outer layer protein I
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vmob_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vmoA (A:)
    rtreytsvitvpngghwgkwgirqfchsgyangfalkvepsqfgrddtalngirlrcldg
    svieslvgkwgtwtsflvcptgylvsfslrseksqgggddtaanniqfrcsdeavlvgdg
    lswgrfgpwskrckicglqtkvespqglrddtalnnvrffcck
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vmoB (B:)
    rtreytsvitvpngghwgkwgirqfchsgyangfalkvepsqfgrddtalngirlrcldg
    svieslvgkwgtwtsflvcptgylvsfslrseksqgggddtaanniqfrcsdeavlvgdg
    lswgrfgpwskrckicglqtkvespqglrddtalnnvrffcck