PDB entry 1vdx

View 1vdx on RCSB PDB site
Description: Crystal Structure of a Pyrococcus horikoshii protein with similarities to 2'5' RNA-ligase
Class: ligase
Keywords: LIGASE, Structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2004-03-25, released 2005-04-12
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.225
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Hypothetical protein PH0099
  Species: Pyrococcus horikoshii [TaxId:53953]
  Database cross-references and differences (RAF-indexed):
  • Uniprot O57823 (0-183)
  Domains in SCOPe 2.03: d1vdxa_
• Heterogens: CL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1vdxA (A:)
  mrafiaidvnesvrdslvraqdyigskeakikfverenlhitlkflgeiteeqaeeikni
  lkkiaekykkhevkvkgigvfpnpnyirviwagiendeiiremareiedelaklgfkkeg
  nfvahitlgrvkfvkdklgltmklkelanedfgsfvvdaielkkstltpkgpiyetlarf
  else