PDB entry 1v9j

View 1v9j on RCSB PDB site
Description: Solution structure of a BolA-like protein from Mus musculus
Class: structural genomics, unknown function
Keywords: Stationary phase morphogene, stress-induced morphogene, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, unknown function
Deposited on 2004-01-26, released 2004-02-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: BolA-like protein RIKEN cDNA 1110025L05
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8BGS2 (27-112)
    • expression tag (0-26)
  Domains in SCOPe 2.08: d1v9ja1, d1v9ja2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1v9jA (A:)
  mkgsshhhhhhssgaslvprgsegaatmelsadylreklrqdleaehvevedttlnrcat
  sfrvlvvsakfegkpllqrhrlvneclaeelphihafeqktltpeqwtrqrre