PDB entry 1uox

View 1uox on RCSB PDB site
Description: urate oxidase from aspergillus flavus complexed with its inhibitor 8-azaxanthine
Class: oxidoreductase
Keywords: oxidoreductase, uric acid degradation, dimeric barrel, tunnel-shaped protein
Deposited on 1997-07-09, released 1998-09-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2003-04-01, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.198
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: urate oxidase
    Species: ASPERGILLUS FLAVUS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uoxa1, d1uoxa2
  • Heterogens: AZA, FCY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uoxA (A:)
    savkaarygkdnvrvykvhkdektgvqtvyemtvcvllegeietsytkadnsvivatdsi
    kntiyitakqnpvtppelfgsilgthfiekynhihaahvnivchrwtrmdidgkphphsf
    irdseekrnvqvdvvegkgidiksslsgltvlkstnsqfwgflrdeyttlketwdrilst
    dvdatwqwknfsglqevrshvpkfdatwatarevtlktfaednsasvqatmykmaeqila
    rqqlietveyslpnkhyfeidlswhkglqntgknaevfapqsdpnglikctvgrs