PDB entry 1uit

View 1uit on RCSB PDB site
Description: Solution structure of RSGI RUH-006, The third PDZ domain OF hDlg5 (KIAA0583) protein [Homo sapiens]
Class: structural genomics, unknown function
Keywords: PDZ domain, hDlg5, MAGUK family, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2003-07-22, released 2004-01-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: human discs large 5 protein
  Species: Homo sapiens [TaxId:9606]
  Gene: Kazusa cDNA hj00729
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8TDM6 (7-110)
    • cloning artifact (0-6)
    • cloning artifact (111-116)
  Domains in SCOPe 2.07: d1uita1, d1uita2, d1uita3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1uitA (A:)
  gssgssggerrkdrpyveeprhvkvqkgseplgisivsgekggiyvskvtvgsiahqagl
  eygdqllefnginlrsateqqarliigqqcdtitilaqynphvhqlsshsrsgpssg