PDB entry 1tz1

View 1tz1 on RCSB PDB site
Description: Solution structure of the PB1 domain of CDC24P (short form)
Class: signaling protein
Keywords: PB1 domain, PCCR, PC motif, OPCA motif, yeast, cell polarity, protein-protein interaction, SIGNALING PROTEIN
Deposited on 2004-07-09, released 2005-09-06
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Cell division control protein 24
  Species: Saccharomyces cerevisiae [TaxId:4932]
  Gene: Cdc24p
  Database cross-references and differences (RAF-indexed):
  • Uniprot P11433 (5-79)
    • cloning artifact (0-4)
  Domains in SCOPe 2.04: d1tz1a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1tz1A (A:)
  gamgsiftllvekvwnfddlimainskisnthnnnispitkikyqdedgdfvvlgsdedw
  nvakemlaennekflnirly